Lineage for d3h8ja2 (3h8j A:183-305)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329325Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2329326Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)
  6. 2329351Protein T4 RNase H [47809] (1 species)
  7. 2329352Species Bacteriophage T4 [TaxId:10665] [47810] (6 PDB entries)
  8. 2329354Domain d3h8ja2: 3h8j A:183-305 [210908]
    Other proteins in same PDB: d3h8ja1
    automated match to d1tfra1
    complexed with na, so4

Details for d3h8ja2

PDB Entry: 3h8j (more details), 1.8 Å

PDB Description: Native T4 RNase H in the absence of divalent metal ions
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3h8ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h8ja2 a.60.7.1 (A:183-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl
lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi
nef

SCOPe Domain Coordinates for d3h8ja2:

Click to download the PDB-style file with coordinates for d3h8ja2.
(The format of our PDB-style files is described here.)

Timeline for d3h8ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h8ja1