SCOPe 2.03: Domain d3h83c_: 3h83 C:

Lineage for d3h83c_ (3h83 C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (18 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [189450] (4 PDB entries)

8. Domain d3h83c_: 3h83 C: [210905]
   automated match to d1r3ub_
   complexed with po4, suc

Details for d3h83c_

PDB Entry: 3h83, 2.06 Å

PDB Description: 2.06 angstrom resolution structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-1) from bacillus anthracis str. 'ames ancestor'

PDB Compounds: (C:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3h83c_:

Sequence; same for both SEQRES and ATOM records:

>d3h83c_ c.61.1.0 (C:) automated matches {Bacillus anthracis [TaxId: 261594]}
ammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdty
lemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrk
aksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys

Timeline for d3h83c_:

• d3h83c_ is new in SCOPe 2.03-stable
  
• d3h83c_ appears in SCOPe 2.04
  
• d3h83c_ appears in the current release, SCOPe 2.08, called d3h83c1