Lineage for d3h83a1 (3h83 A:-10-179)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891884Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries)
  8. 2891886Domain d3h83a1: 3h83 A:-10-179 [210903]
    Other proteins in same PDB: d3h83a2, d3h83b2, d3h83c2, d3h83d2
    automated match to d1r3ub_
    complexed with po4

Details for d3h83a1

PDB Entry: 3h83 (more details), 2.06 Å

PDB Description: 2.06 angstrom resolution structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-1) from bacillus anthracis str. 'ames ancestor'
PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3h83a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h83a1 c.61.1.0 (A:-10-179) automated matches {Bacillus anthracis [TaxId: 261594]}
gtenlyfqsnammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfm
adllkrtdtylemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltls
ylvdlfkyrkaksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpy
vgvlkpsvys

SCOPe Domain Coordinates for d3h83a1:

Click to download the PDB-style file with coordinates for d3h83a1.
(The format of our PDB-style files is described here.)

Timeline for d3h83a1: