Lineage for d3h81c_ (3h81 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113412Species Mycobacterium tuberculosis [TaxId:1773] [189677] (8 PDB entries)
  8. 2113420Domain d3h81c_: 3h81 C: [210902]
    automated match to d3r9tb_
    complexed with ca, gol

Details for d3h81c_

PDB Entry: 3h81 (more details), 1.8 Å

PDB Description: crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis
PDB Compounds: (C:) enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d3h81c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h81c_ c.14.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
gmaafiekrapqfthr

SCOPe Domain Coordinates for d3h81c_:

Click to download the PDB-style file with coordinates for d3h81c_.
(The format of our PDB-style files is described here.)

Timeline for d3h81c_: