SCOPe 2.03: Domain d3h81b_: 3h81 B:

Lineage for d3h81b_ (3h81 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (42 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189677] (3 PDB entries)

8. Domain d3h81b_: 3h81 B: [210901]
   automated match to d3r9tb_
   complexed with ca, gol

Details for d3h81b_

PDB Entry: 3h81, 1.8 Å

PDB Description: crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis

PDB Compounds: (B:) enoyl-CoA hydratase echA8

SCOPe Domain Sequences for d3h81b_:

Sequence; same for both SEQRES and ATOM records:

>d3h81b_ c.14.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tyetilverdqrvgiitlnrpqalnalnsqvmnevtsaateldddpdigaiiitgsakaf
aagadikemadltfadaftadffatwgklaavrtptiaavagyalgggcelammcdvlia
adtakfgqpeiklgvlpgmggsqrltraigkakamdliltgrtmdaaeaersglvsrvvp
addlltearatattisqmsasaarmakeavnrafesslsegllyerrlfhsafatedqse
gmaafiekrapqfth

Timeline for d3h81b_:

• d3h81b_ is new in SCOPe 2.03-stable
  
• d3h81b_ appears in SCOPe 2.04
  
• d3h81b_ appears in the current release, SCOPe 2.08