SCOPe 2.08: Domain d3h80a1: 3h80 A:1-208

Lineage for d3h80a1 (3h80 A:1-208)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Leishmania major [TaxId:347515] [195250] (5 PDB entries)

8. Domain d3h80a1: 3h80 A:1-208 [210899]
   Other proteins in same PDB: d3h80a2
   automated match to d3u67a_
   complexed with anp, edo, mg

Details for d3h80a1

PDB Entry: 3h80, 2 Å

PDB Description: Crystal structure of the amino-terminal domain of HSP90 from Leishmania major, LmjF33.0312:M1-K213

PDB Compounds: (A:) Heat shock protein 83-1

SCOPe Domain Sequences for d3h80a1:

Sequence; same for both SEQRES and ATOM records:

>d3h80a1 d.122.1.1 (A:1-208) automated matches {Leishmania major [TaxId: 347515]}
mtetfafqaeinqlmsliintfysnkeiflrelisnasdacdkiryqsltdpsvlgespr
lcirvvpdkenktltvedngigmtkadlvnnlgtiarsgtkafmealeaggdmsmigqfg
vgfysaylvadrvtvtsknnsdesyvwessaggtftitstpesdmkrgtritlhlkedqm
eyleprrlkelikkhsefigydielmve

Timeline for d3h80a1:

• d3h80a1 first appeared in SCOPe 2.03, called d3h80a_
  
• d3h80a1 appears in SCOPe 2.07