SCOP 1.65: Domain d1igch2: 1igc H:120-222

Lineage for d1igch2 (1igc H:120-222)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1igch2: 1igc H:120-222 [21089]
   Other proteins in same PDB: d1igca_, d1igch1, d1igcl1, d1igcl2
   part of Fab MoPC21

Details for d1igch2

PDB Entry: 1igc, 2.6 Å

PDB Description: igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus

SCOP Domain Sequences for d1igch2:

Sequence; same for both SEQRES and ATOM records:

>d1igch2 b.1.1.2 (H:120-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1igch2:

• d1igch2 first appeared (with stable ids) in SCOP 1.55
  
• d1igch2 appears in SCOP 1.63
  
• d1igch2 appears in SCOP 1.67
  
• d1igch2 appears in the current release, SCOPe 2.08