SCOP 1.55: Domain d1igch2: 1igc H:120-222

Lineage for d1igch2 (1igc H:120-222)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab MoPC21 (mouse), kappa L chain [49019] (1 PDB entry)

8. Domain d1igch2: 1igc H:120-222 [21089]
   Other proteins in same PDB: d1igca_, d1igch1, d1igcl1

Details for d1igch2

PDB Entry: 1igc, 2.6 Å

PDB Description: igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus

SCOP Domain Sequences for d1igch2:

Sequence; same for both SEQRES and ATOM records:

>d1igch2 b.1.1.2 (H:120-222) Immunoglobulin (constant domains of L and H chains) {Fab MoPC21 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

Timeline for d1igch2:

• d1igch2 appears in SCOP 1.57
  
• d1igch2 appears in the current release, SCOPe 2.08