| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
| Species Fab MoPC21 (mouse), kappa L chain [49019] (1 PDB entry) |
| Domain d1igch2: 1igc H:120-222 [21089] Other proteins in same PDB: d1igca_, d1igch1, d1igcl1 |
PDB Entry: 1igc (more details), 2.6 Å
SCOP Domain Sequences for d1igch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igch2 b.1.1.2 (H:120-222) Immunoglobulin (constant domains of L and H chains) {Fab MoPC21 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
Timeline for d1igch2: