SCOPe 2.07: Domain d3h55b1: 3h55 B:18-309

Lineage for d3h55b1 (3h55 B:18-309)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (33 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225770] (14 PDB entries)

8. Domain d3h55b1: 3h55 B:18-309 [210889]
   Other proteins in same PDB: d3h55a2, d3h55b2
   automated match to d1ktba2
   complexed with bma, cit, fuc, gla, man, nag

Details for d3h55b1

PDB Entry: 3h55, 1.91 Å

PDB Description: crystal structure of human alpha-n-acetylgalactosaminidase, complex with galactose

PDB Compounds: (B:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d3h55b1:

Sequence; same for both SEQRES and ATOM records:

>d3h55b1 c.1.8.1 (B:18-309) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdp

Timeline for d3h55b1:

• d3h55b1 first appeared in SCOPe 2.03
  
• d3h55b1 appears in SCOPe 2.06
  
• d3h55b1 appears in the current release, SCOPe 2.08