SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3h55a2 (3h55 A:310-404)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066963Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2066964Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2067553Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2067554Protein automated matches [226835] (33 species)
    not a true protein
  7. 2067629Species Human (Homo sapiens) [TaxId:9606] [225771] (21 PDB entries)
  8. 2067643Domain d3h55a2: 3h55 A:310-404 [210888]
    Other proteins in same PDB: d3h55a1, d3h55b1
    automated match to d1ktba1
    complexed with cit, gla, nag

Details for d3h55a2

PDB Entry: 3h55 (more details), 1.91 Å

PDB Description: Crystal Structure of human alpha-N-acetylgalactosaminidase, Complex with Galactose
PDB Compounds: (A:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d3h55a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h55a2 b.71.1.0 (A:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq
dvysgdiisglrdetnftviinpsgvvmwylypik

SCOPe Domain Coordinates for d3h55a2:

Click to download the PDB-style file with coordinates for d3h55a2.
(The format of our PDB-style files is described here.)

Timeline for d3h55a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h55a1