SCOPe 2.08: Domain d3h54a2: 3h54 A:310-404

Lineage for d3h54a2 (3h54 A:310-404)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)

8. Domain d3h54a2: 3h54 A:310-404 [210884]
   Other proteins in same PDB: d3h54a1, d3h54b1
   automated match to d1ktba1
   complexed with a2g, gol, nag

Details for d3h54a2

PDB Entry: 3h54, 2.2 Å

PDB Description: crystal structure of human alpha-n-acetylgalactosaminidase,complex with galnac

PDB Compounds: (A:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d3h54a2:

Sequence; same for both SEQRES and ATOM records:

>d3h54a2 b.71.1.0 (A:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq
dvysgdiisglrdetnftviinpsgvvmwylypik

Timeline for d3h54a2:

• d3h54a2 first appeared in SCOPe 2.03
  
• d3h54a2 appears in SCOPe 2.07