Lineage for d3h53b2 (3h53 B:310-404)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420422Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2420423Protein automated matches [226835] (41 species)
    not a true protein
  7. 2420534Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)
  8. 2420554Domain d3h53b2: 3h53 B:310-404 [210882]
    Other proteins in same PDB: d3h53a1, d3h53b1
    automated match to d1ktba1
    complexed with bma, fuc, gol, man, nag

Details for d3h53b2

PDB Entry: 3h53 (more details), 2.01 Å

PDB Description: crystal structure of human alpha-n-acetylgalactosaminidase
PDB Compounds: (B:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d3h53b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h53b2 b.71.1.0 (B:310-404) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgiqgrrihkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaq
dvysgdiisglrdetnftviinpsgvvmwylypik

SCOPe Domain Coordinates for d3h53b2:

Click to download the PDB-style file with coordinates for d3h53b2.
(The format of our PDB-style files is described here.)

Timeline for d3h53b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h53b1