![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein automated matches [190099] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225770] (7 PDB entries) |
![]() | Domain d3h53b1: 3h53 B:18-309 [210881] Other proteins in same PDB: d3h53a2, d3h53b2 automated match to d1ktba2 complexed with gol, nag |
PDB Entry: 3h53 (more details), 2.01 Å
SCOPe Domain Sequences for d3h53b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h53b1 c.1.8.1 (B:18-309) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdp
Timeline for d3h53b1: