![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
![]() | Domain d1igcl2: 1igc L:109-213 [21088] Other proteins in same PDB: d1igca_, d1igch1, d1igch2, d1igcl1 part of Fab MoPC21 |
PDB Entry: 1igc (more details), 2.6 Å
SCOP Domain Sequences for d1igcl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igcl2 b.1.1.2 (L:109-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidserqngvlnswtdqdsk dstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1igcl2: