SCOP 1.63: Domain d1igcl2: 1igc L:109-213

Lineage for d1igcl2 (1igc L:109-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab MoPC21 (mouse), kappa L chain [49019] (1 PDB entry)

8. Domain d1igcl2: 1igc L:109-213 [21088]
   Other proteins in same PDB: d1igca_, d1igch1, d1igcl1

Details for d1igcl2

PDB Entry: 1igc, 2.6 Å

PDB Description: igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus

SCOP Domain Sequences for d1igcl2:

Sequence; same for both SEQRES and ATOM records:

>d1igcl2 b.1.1.2 (L:109-213) Immunoglobulin (constant domains of L and H chains) {Fab MoPC21 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidserqngvlnswtdqdsk
dstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1igcl2:

• d1igcl2 first appeared (with stable ids) in SCOP 1.55
  
• d1igcl2 appears in SCOP 1.61
  
• d1igcl2 appears in SCOP 1.65
  
• d1igcl2 appears in the current release, SCOPe 2.08