SCOPe 2.03: Domain d3h4fc2: 3h4f C:162-339

Lineage for d3h4fc2 (3h4f C:162-339)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (8 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [226762] (3 PDB entries)

8. Domain d3h4fc2: 3h4f C:162-339 [210871]
   automated match to d1mzya2
   complexed with cu

Details for d3h4fc2

PDB Entry: 3h4f, 2.1 Å

PDB Description: met62leu variant of nitrite reductase from alcaligenes faeclis

PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d3h4fc2:

Sequence; same for both SEQRES and ATOM records:

>d3h4fc2 b.6.1.0 (C:162-339) automated matches {Alcaligenes faecalis [TaxId: 511]}
lhdgkgkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfn
gavgaltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetw
fipggaagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d3h4fc2:

• d3h4fc2 is new in SCOPe 2.03-stable
  
• d3h4fc2 appears in SCOPe 2.04
  
• d3h4fc2 appears in the current release, SCOPe 2.08