Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries) |
Domain d1ikfl2: 1ikf L:108-214 [21086] Other proteins in same PDB: d1ikfh1, d1ikfh2, d1ikfl1 part of an anti-cyclosporin A Fab complexed with aba |
PDB Entry: 1ikf (more details), 2.5 Å
SCOP Domain Sequences for d1ikfl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ikfl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnraac
Timeline for d1ikfl2: