Lineage for d3h45x1 (3h45 X:3-254)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858084Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1858085Protein Glycerol kinase [53090] (2 species)
  7. 1858086Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
    Uniprot O34153 5-491
  8. 1858117Domain d3h45x1: 3h45 X:3-254 [210858]
    automated match to d1glfo1
    complexed with edo, po4

Details for d3h45x1

PDB Entry: 3h45 (more details), 2.65 Å

PDB Description: glycerol kinase h232e with ethylene glycol
PDB Compounds: (X:) glycerol kinase

SCOPe Domain Sequences for d3h45x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h45x1 c.55.1.4 (X:3-254) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
eknyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsvia
gafiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdght
emihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvt
dysnasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyefygsevpiag
magdqqaalfgq

SCOPe Domain Coordinates for d3h45x1:

Click to download the PDB-style file with coordinates for d3h45x1.
(The format of our PDB-style files is described here.)

Timeline for d3h45x1: