| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.4: Glycerol kinase [53089] (1 protein) |
| Protein Glycerol kinase [53090] (2 species) |
| Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries) Uniprot O34153 5-491 |
| Domain d3h45o1: 3h45 O:2-254 [210856] automated match to d1glfo1 complexed with edo, po4 |
PDB Entry: 3h45 (more details), 2.65 Å
SCOPe Domain Sequences for d3h45o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h45o1 c.55.1.4 (O:2-254) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
aeknyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsvi
agafiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdgh
temihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhv
tdysnasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyefygsevpia
gmagdqqaalfgq
Timeline for d3h45o1: