SCOPe 2.03: Domain d3h42l1: 3h42 L:1-112

Lineage for d3h42l1 (3h42 L:1-112)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)

8. Domain d3h42l1: 3h42 L:1-112 [210850]
   Other proteins in same PDB: d3h42l2
   automated match to d1aqkl1
   complexed with na

Details for d3h42l1

PDB Entry: 3h42, 2.3 Å

PDB Description: crystal structure of pcsk9 in complex with fab from ldlr competitive antibody

PDB Compounds: (L:) Fab from LDLR competitive antibody: Light chain

SCOPe Domain Sequences for d3h42l1:

Sequence; same for both SEQRES and ATOM records:

>d3h42l1 b.1.1.1 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapkllisgnsnrpsgv
pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgsvfgggtkltvlg

Timeline for d3h42l1:

• d3h42l1 is new in SCOPe 2.03-stable
  
• d3h42l1 appears in SCOPe 2.04
  
• d3h42l1 appears in the current release, SCOPe 2.08