Lineage for d1fpth2 (1fpt H:114-228)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104104Species Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain [49017] (1 PDB entry)
  8. 104105Domain d1fpth2: 1fpt H:114-228 [21085]
    Other proteins in same PDB: d1fpth1, d1fptl1

Details for d1fpth2

PDB Entry: 1fpt (more details), 3 Å

PDB Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope

SCOP Domain Sequences for d1fpth2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpth2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1fpth2:

Click to download the PDB-style file with coordinates for d1fpth2.
(The format of our PDB-style files is described here.)

Timeline for d1fpth2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fpth1