Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain [49017] (1 PDB entry) |
Domain d1fpth2: 1fpt H:114-228 [21085] Other proteins in same PDB: d1fpth1, d1fptl1 |
PDB Entry: 1fpt (more details), 3 Å
SCOP Domain Sequences for d1fpth2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpth2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1fpth2: