SCOP 1.55: Domain d1fpth2: 1fpt H:114-228

Lineage for d1fpth2 (1fpt H:114-228)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain [49017] (1 PDB entry)

8. Domain d1fpth2: 1fpt H:114-228 [21085]
   Other proteins in same PDB: d1fpth1, d1fptl1

Details for d1fpth2

PDB Entry: 1fpt, 3 Å

PDB Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope

SCOP Domain Sequences for d1fpth2:

Sequence; same for both SEQRES and ATOM records:

>d1fpth2 b.1.1.2 (H:114-228) Immunoglobulin (constant domains of L and H chains) {Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1fpth2:

• d1fpth2 appears in SCOP 1.57
  
• d1fpth2 appears in the current release, SCOPe 2.08