![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.4: Glycerol kinase [53089] (1 protein) |
![]() | Protein Glycerol kinase [53090] (2 species) |
![]() | Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries) Uniprot O34153 5-491 |
![]() | Domain d3h3oc1: 3h3o C:5-254 [210840] automated match to d1glfo1 complexed with edo, po4 |
PDB Entry: 3h3o (more details), 2.3 Å
SCOPe Domain Sequences for d3h3oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3oc1 c.55.1.4 (C:5-254) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} nyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviaga fiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtem ihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdy snasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyrfygsevpiagma gdqqaalfgq
Timeline for d3h3oc1: