SCOPe 2.08: Domain d3h3ob2: 3h3o B:255-501

Lineage for d3h3ob2 (3h3o B:255-501)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
duplication contains two domains of this fold
Family c.55.1.4: Glycerol kinase [53089] (1 protein)
Protein Glycerol kinase [53090] (2 species)
Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
Uniprot O34153 5-491
Domain d3h3ob2: 3h3o B:255-501 [210839]
automated match to d3ezwd2
complexed with edo, po4

Details for d3h3ob2

PDB Entry: 3h3o (more details), 2.3 Å

PDB Description: glycerol kinase h232r with ethylene glycol

PDB Compounds: (B:) glycerol kinase

SCOPe Domain Sequences for d3h3ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3ob2 c.55.1.4 (B:255-501) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
mafekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvagsai
qwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrgttk
edfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidvqra
anlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqavaat
qtfkfka

SCOPe Domain Coordinates for d3h3ob2:

Click to download the PDB-style file with coordinates for d3h3ob2.
(The format of our PDB-style files is described here.)

Timeline for d3h3ob2: