SCOPe 2.06: Domain d3h3nx1: 3h3n X:2-254

Lineage for d3h3nx1 (3h3n X:2-254)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
   Uniprot O34153 5-491

8. Domain d3h3nx1: 3h3n X:2-254 [210836]
   automated match to d1glfo1
   complexed with edo, gol, po4

Details for d3h3nx1

PDB Entry: 3h3n, 1.73 Å

PDB Description: glycerol kinase h232r with glycerol

PDB Compounds: (X:) glycerol kinase

SCOPe Domain Sequences for d3h3nx1:

Sequence; same for both SEQRES and ATOM records:

>d3h3nx1 c.55.1.4 (X:2-254) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
aeknyvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsvi
agafiesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdgh
temihektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhv
tdysnasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyrfygsevpia
gmagdqqaalfgq

Timeline for d3h3nx1:

• d3h3nx1 first appeared in SCOPe 2.03
  
• d3h3nx1 appears in SCOPe 2.05
  
• d3h3nx1 appears in SCOPe 2.07
  
• d3h3nx1 appears in the current release, SCOPe 2.08