SCOPe 2.04: Domain d3h3jb2: 3h3j B:149-317

Lineage for d3h3jb2 (3h3j B:149-317)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (24 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [225656] (3 PDB entries)

8. Domain d3h3jb2: 3h3j B:149-317 [210833]
   Other proteins in same PDB: d3h3ja1, d3h3jb1
   automated match to d2ldba2
   complexed with gol, nad, pyr; mutant

Details for d3h3jb2

PDB Entry: 3h3j, 1.8 Å

PDB Description: crystal structure of lactate dehydrogenase mutant (a85r) from staphylococcus aureus complexed with nad and pyruvate

PDB Compounds: (B:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d3h3jb2:

Sequence; same for both SEQRES and ATOM records:

>d3h3jb2 d.162.1.0 (B:149-317) automated matches {Staphylococcus aureus [TaxId: 93062]}
tildsarfrlllseafdvaprsvdaqiigehgdtelpvwshaniagqplktlleqrpegk
aqieqifvqtrdaaydiiqakgatyygvamglariteaifrnedavltvsallegeyeee
dvyigvpavinrngirnvveiplndeeqskfahsaktlkdimaeaeelk

Timeline for d3h3jb2:

• d3h3jb2 first appeared in SCOPe 2.03
  
• d3h3jb2 appears in SCOPe 2.05
  
• d3h3jb2 appears in the current release, SCOPe 2.08