Lineage for d3h3jb2 (3h3j B:149-317)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1441394Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1441395Protein automated matches [226850] (21 species)
    not a true protein
  7. 1441503Species Staphylococcus aureus [TaxId:93062] [225656] (3 PDB entries)
  8. 1441509Domain d3h3jb2: 3h3j B:149-317 [210833]
    Other proteins in same PDB: d3h3ja1, d3h3jb1
    automated match to d2ldba2
    complexed with gol, nad, pyr; mutant

Details for d3h3jb2

PDB Entry: 3h3j (more details), 1.8 Å

PDB Description: crystal structure of lactate dehydrogenase mutant (a85r) from staphylococcus aureus complexed with nad and pyruvate
PDB Compounds: (B:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d3h3jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3jb2 d.162.1.0 (B:149-317) automated matches {Staphylococcus aureus [TaxId: 93062]}
tildsarfrlllseafdvaprsvdaqiigehgdtelpvwshaniagqplktlleqrpegk
aqieqifvqtrdaaydiiqakgatyygvamglariteaifrnedavltvsallegeyeee
dvyigvpavinrngirnvveiplndeeqskfahsaktlkdimaeaeelk

SCOPe Domain Coordinates for d3h3jb2:

Click to download the PDB-style file with coordinates for d3h3jb2.
(The format of our PDB-style files is described here.)

Timeline for d3h3jb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h3jb1