Lineage for d1rmfh2 (1rmf H:120-216)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159994Species Fab R6.5 (mouse), kappa L chain [49016] (1 PDB entry)
  8. 159995Domain d1rmfh2: 1rmf H:120-216 [21083]
    Other proteins in same PDB: d1rmfh1, d1rmfl1

Details for d1rmfh2

PDB Entry: 1rmf (more details), 2.8 Å

PDB Description: structures of a monoclonal anti-icam-1 antibody r6.5 fragment at 2.8 angstroms resolution

SCOP Domain Sequences for d1rmfh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmfh2 b.1.1.2 (H:120-216) Immunoglobulin (constant domains of L and H chains) {Fab R6.5 (mouse), kappa L chain}
akttapsvtplapvcgdttgssvtlgvlvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkki

SCOP Domain Coordinates for d1rmfh2:

Click to download the PDB-style file with coordinates for d1rmfh2.
(The format of our PDB-style files is described here.)

Timeline for d1rmfh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rmfh1