Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d3h3bd2: 3h3b D:136-253 [210813] Other proteins in same PDB: d3h3ba1, d3h3ba2, d3h3ba3, d3h3bb1, d3h3bb2, d3h3bb3 automated match to d1nqba1 |
PDB Entry: 3h3b (more details), 2.45 Å
SCOPe Domain Sequences for d3h3bd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3bd2 b.1.1.0 (D:136-253) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vqlqqsgpevvktgasvkisckasgysftgyfinwvkknsgkspewighisssyatstyn qkfknkaaftvdtssstafmqlnsltsedsavyycvrsgnyeeyamdywgqgtsvtvs
Timeline for d3h3bd2: