| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (28 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
| Domain d3h3bd1: 3h3b D:-2-113 [210812] Other proteins in same PDB: d3h3ba1, d3h3ba2, d3h3ba3, d3h3bb1, d3h3bb2, d3h3bb3 automated match to d1nqba2 |
PDB Entry: 3h3b (more details), 2.45 Å
SCOPe Domain Sequences for d3h3bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3bd1 b.1.1.0 (D:-2-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspklliswa
ftrksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleik
Timeline for d3h3bd1: