Lineage for d3h3bc2 (3h3b C:136-253)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297032Domain d3h3bc2: 3h3b C:136-253 [210811]
    Other proteins in same PDB: d3h3ba1, d3h3ba2, d3h3bb1, d3h3bb2
    automated match to d1nqba1

Details for d3h3bc2

PDB Entry: 3h3b (more details), 2.45 Å

PDB Description: Crystal structure of the single-chain Fv (scFv) fragment of an anti-ErbB2 antibody chA21 in complex with residues 1-192 of ErbB2 extracellular domain
PDB Compounds: (C:) anti-ErbB2 antibody chA21

SCOPe Domain Sequences for d3h3bc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3bc2 b.1.1.0 (C:136-253) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqqsgpevvktgasvkisckasgysftgyfinwvkknsgkspewighisssyatstyn
qkfknkaaftvdtssstafmqlnsltsedsavyycvrsgnyeeyamdywgqgtsvtvs

SCOPe Domain Coordinates for d3h3bc2:

Click to download the PDB-style file with coordinates for d3h3bc2.
(The format of our PDB-style files is described here.)

Timeline for d3h3bc2: