SCOPe 2.03: Domain d3h3bc2: 3h3b C:136-253

Lineage for d3h3bc2 (3h3b C:136-253)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d3h3bc2: 3h3b C:136-253 [210811]
   Other proteins in same PDB: d3h3ba1, d3h3ba2, d3h3bb1, d3h3bb2
   automated match to d1nqba1

Details for d3h3bc2

PDB Entry: 3h3b, 2.45 Å

PDB Description: Crystal structure of the single-chain Fv (scFv) fragment of an anti-ErbB2 antibody chA21 in complex with residues 1-192 of ErbB2 extracellular domain

PDB Compounds: (C:) anti-ErbB2 antibody chA21

SCOPe Domain Sequences for d3h3bc2:

Sequence; same for both SEQRES and ATOM records:

>d3h3bc2 b.1.1.0 (C:136-253) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vqlqqsgpevvktgasvkisckasgysftgyfinwvkknsgkspewighisssyatstyn
qkfknkaaftvdtssstafmqlnsltsedsavyycvrsgnyeeyamdywgqgtsvtvs

Timeline for d3h3bc2:

• d3h3bc2 is new in SCOPe 2.03-stable
  
• d3h3bc2 appears in SCOPe 2.04
  
• d3h3bc2 appears in the current release, SCOPe 2.08