![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (23 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
![]() | Domain d3h3bc2: 3h3b C:136-253 [210811] Other proteins in same PDB: d3h3ba1, d3h3ba2, d3h3bb1, d3h3bb2 automated match to d1nqba1 |
PDB Entry: 3h3b (more details), 2.45 Å
SCOPe Domain Sequences for d3h3bc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3bc2 b.1.1.0 (C:136-253) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vqlqqsgpevvktgasvkisckasgysftgyfinwvkknsgkspewighisssyatstyn qkfknkaaftvdtssstafmqlnsltsedsavyycvrsgnyeeyamdywgqgtsvtvs
Timeline for d3h3bc2: