Lineage for d3h3bc1 (3h3b C:-2-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766897Domain d3h3bc1: 3h3b C:-2-112 [210810]
    Other proteins in same PDB: d3h3ba1, d3h3ba2, d3h3bb1, d3h3bb2
    automated match to d1nqba2

Details for d3h3bc1

PDB Entry: 3h3b (more details), 2.45 Å

PDB Description: Crystal structure of the single-chain Fv (scFv) fragment of an anti-ErbB2 antibody chA21 in complex with residues 1-192 of ErbB2 extracellular domain
PDB Compounds: (C:) anti-ErbB2 antibody chA21

SCOPe Domain Sequences for d3h3bc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3bc1 b.1.1.0 (C:-2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspklliswa
ftrksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrlei

SCOPe Domain Coordinates for d3h3bc1:

Click to download the PDB-style file with coordinates for d3h3bc1.
(The format of our PDB-style files is described here.)

Timeline for d3h3bc1: