SCOP 1.73: Domain d1fbiq2: 1fbi Q:122-221

Lineage for d1fbiq2 (1fbi Q:122-221)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1fbiq2: 1fbi Q:122-221 [21081]
   Other proteins in same PDB: d1fbih1, d1fbil1, d1fbil2, d1fbip1, d1fbip2, d1fbiq1, d1fbix_, d1fbiy_
   part of Fab F9.13.7

Details for d1fbiq2

PDB Entry: 1fbi, 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

PDB Compounds: (Q:) igg1 f9.13.7 fab (heavy chain)

SCOP Domain Sequences for d1fbiq2:

Sequence; same for both SEQRES and ATOM records:

>d1fbiq2 b.1.1.2 (Q:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1fbiq2:

• d1fbiq2 first appeared (with stable ids) in SCOP 1.55
  
• d1fbiq2 appears in SCOP 1.71
  
• d1fbiq2 appears in SCOP 1.75
  
• d1fbiq2 appears in the current release, SCOPe 2.08