SCOP 1.57: Domain d1fbiq2: 1fbi Q:122-221

Lineage for d1fbiq2 (1fbi Q:122-221)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab F9.13.7 (mouse), kappa L chain [49015] (1 PDB entry)

8. Domain d1fbiq2: 1fbi Q:122-221 [21081]
   Other proteins in same PDB: d1fbih1, d1fbil1, d1fbip1, d1fbiq1, d1fbix_, d1fbiy_

Details for d1fbiq2

PDB Entry: 1fbi, 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbiq2:

Sequence; same for both SEQRES and ATOM records:

>d1fbiq2 b.1.1.2 (Q:122-221) Immunoglobulin (constant domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain}
sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1fbiq2:

• d1fbiq2 first appeared (with stable ids) in SCOP 1.55
  
• d1fbiq2 appears in SCOP 1.59
  
• d1fbiq2 appears in the current release, SCOPe 2.08