SCOPe 2.08: Domain d3h2uc_: 3h2u C:

Lineage for d3h2uc_ (3h2u C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein automated matches [226863] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries)

8. Domain d3h2uc_: 3h2u C: [210808]
   automated match to d1qkrb_
   protein/RNA complex

Details for d3h2uc_

PDB Entry: 3h2u, 2.75 Å

PDB Description: Human raver1 RRM1, RRM2, and RRM3 domains in complex with human vinculin tail domain Vt

PDB Compounds: (C:) vinculin

SCOPe Domain Sequences for d3h2uc_:

Sequence, based on SEQRES records:

>d3h2uc_ a.24.9.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eefpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsg
tkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvk
atmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrkt
p

Sequence, based on observed residues (ATOM records):

>d3h2uc_ a.24.9.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eefpeqevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsgtkr
aliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatm
lgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirftlrwvrktp

Timeline for d3h2uc_:

• d3h2uc_ first appeared in SCOPe 2.03
  
• d3h2uc_ appears in SCOPe 2.07