Lineage for d3h2ob_ (3h2o B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089691Protein Dihydropteroate synthetase [51719] (4 species)
  7. 2089692Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries)
    Uniprot Q81VW8
  8. 2089760Domain d3h2ob_: 3h2o B: [210806]
    automated match to d1tx2a_
    complexed with b63, so4

Details for d3h2ob_

PDB Entry: 3h2o (more details), 2.7 Å

PDB Description: structural studies of pterin-based inhibitors of dihydropteroate synthase
PDB Compounds: (B:) dihydropteroate synthase

SCOPe Domain Sequences for d3h2ob_:

Sequence, based on SEQRES records: (download)

>d3h2ob_ c.1.21.1 (B:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahii
diggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiin
diwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrden
iildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtga
tvclgiekgcefvrvhdvkemsrmakmmdamigk

Sequence, based on observed residues (ATOM records): (download)

>d3h2ob_ c.1.21.1 (B:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mkwdydlrcgeytlnlnektlimgilnvtpdggsynevdaavrhakemrdegahiidigg
evsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkia
evaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfakt
peqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcef
vrvhdvkemsrmakmmdamigk

SCOPe Domain Coordinates for d3h2ob_:

Click to download the PDB-style file with coordinates for d3h2ob_.
(The format of our PDB-style files is described here.)

Timeline for d3h2ob_: