Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
Domain d1fbip2: 1fbi P:108-214 [21080] Other proteins in same PDB: d1fbih1, d1fbih2, d1fbil1, d1fbip1, d1fbiq1, d1fbiq2, d1fbix_, d1fbiy_ part of Fab F9.13.7 |
PDB Entry: 1fbi (more details), 3 Å
SCOP Domain Sequences for d1fbip2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbip2 b.1.1.2 (P:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1fbip2: