Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab F9.13.7 (mouse), kappa L chain [49015] (1 PDB entry) |
Domain d1fbip2: 1fbi P:108-214 [21080] Other proteins in same PDB: d1fbih1, d1fbil1, d1fbip1, d1fbiq1, d1fbix_, d1fbiy_ |
PDB Entry: 1fbi (more details), 3 Å
SCOP Domain Sequences for d1fbip2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbip2 b.1.1.2 (P:108-214) Immunoglobulin (constant domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1fbip2: