SCOPe 2.05: Domain d3h2ea_: 3h2e A:

Lineage for d3h2ea_ (3h2e A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)

6. Protein Dihydropteroate synthetase [51719] (4 species)

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (32 PDB entries)
   Uniprot Q81VW8

8. Domain d3h2ea_: 3h2e A: [210797]
   automated match to d1tx2a_
   complexed with b59, so4

Details for d3h2ea_

PDB Entry: 3h2e, 2 Å

PDB Description: structural studies of pterin-based inhibitors of dihydropteroate synthase

PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d3h2ea_:

Sequence; same for both SEQRES and ATOM records:

>d3h2ea_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid
iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind
iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni
ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat
vclgiekgcefvrvhdvkemsrmakmmdamigk

Timeline for d3h2ea_:

• d3h2ea_ first appeared in SCOPe 2.03
  
• d3h2ea_ appears in SCOPe 2.04
  
• d3h2ea_ appears in SCOPe 2.06
  
• d3h2ea_ appears in the current release, SCOPe 2.08