![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein automated matches [226926] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225864] (7 PDB entries) |
![]() | Domain d3h0sb1: 3h0s B:1480-1814 [210772] automated match to d1uyrb1 complexed with b38, so4 |
PDB Entry: 3h0s (more details), 2.43 Å
SCOPe Domain Sequences for d3h0sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h0sb1 c.14.1.4 (B:1480-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlgg tqimynngvshltavddlagvekivewmsyvpakr
Timeline for d3h0sb1:
![]() Domains from other chains: (mouse over for more information) d3h0sa1, d3h0sa2, d3h0sc1, d3h0sc2 |