![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein automated matches [226926] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225864] (7 PDB entries) |
![]() | Domain d3h0qb1: 3h0q B:1482-1814 [210766] automated match to d1uyrb1 complexed with b37 |
PDB Entry: 3h0q (more details), 2.5 Å
SCOPe Domain Sequences for d3h0qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h0qb1 c.14.1.4 (B:1482-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq imynngvshltavddlagvekivewmsyvpakr
Timeline for d3h0qb1:
![]() Domains from other chains: (mouse over for more information) d3h0qa1, d3h0qa2, d3h0qc1, d3h0qc2 |