SCOPe 2.03: Domain d3h0qa1: 3h0q A:1482-1814

Lineage for d3h0qa1 (3h0q A:1482-1814)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein automated matches [226926] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225864] (4 PDB entries)

8. Domain d3h0qa1: 3h0q A:1482-1814 [210764]
   automated match to d1uyrb1
   complexed with b37

Details for d3h0qa1

PDB Entry: 3h0q, 2.5 Å

PDB Description: crystal structure of the carboxyltransferase domain of acetyl-coenzyme a carboxylase in complex with compound 3

PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3h0qa1:

Sequence; same for both SEQRES and ATOM records:

>d3h0qa1 c.14.1.4 (A:1482-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
imynngvshltavddlagvekivewmsyvpakr

Timeline for d3h0qa1:

• d3h0qa1 is new in SCOPe 2.03-stable
  
• d3h0qa1 appears in SCOPe 2.04
  
• d3h0qa1 appears in the current release, SCOPe 2.08