Lineage for d3h0qa1 (3h0q A:1482-1814)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853345Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2853512Protein automated matches [226926] (3 species)
    not a true protein
  7. 2853513Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225864] (7 PDB entries)
  8. 2853534Domain d3h0qa1: 3h0q A:1482-1814 [210764]
    automated match to d1uyrb1
    complexed with b37

Details for d3h0qa1

PDB Entry: 3h0q (more details), 2.5 Å

PDB Description: crystal structure of the carboxyltransferase domain of acetyl-coenzyme a carboxylase in complex with compound 3
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3h0qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h0qa1 c.14.1.4 (A:1482-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
imynngvshltavddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d3h0qa1:

Click to download the PDB-style file with coordinates for d3h0qa1.
(The format of our PDB-style files is described here.)

Timeline for d3h0qa1: