Lineage for d3h0jc1 (3h0j C:1492-1814)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354508Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1354670Protein automated matches [226926] (3 species)
    not a true protein
  7. 1354671Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225864] (4 PDB entries)
  8. 1354694Domain d3h0jc1: 3h0j C:1492-1814 [210762]
    automated match to d1uyrb1
    complexed with b36

Details for d3h0jc1

PDB Entry: 3h0j (more details), 2.8 Å

PDB Description: Crystal structure of the carboxyltransferase domain of acetyl-coenzyme A carboxylase in complex with compound 2
PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3h0jc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h0jc1 c.14.1.4 (C:1492-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
svgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshl
tavddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d3h0jc1:

Click to download the PDB-style file with coordinates for d3h0jc1.
(The format of our PDB-style files is described here.)

Timeline for d3h0jc1: