SCOP 1.67: Domain d1mrcl2: 1mrc L:109-211

Lineage for d1mrcl2 (1mrc L:109-211)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1mrcl2: 1mrc L:109-211 [21076]
   Other proteins in same PDB: d1mrch1, d1mrch2, d1mrcl1
   part of Fab Jel 103
   complexed with imd, so4, zn

Details for d1mrcl2

PDB Entry: 1mrc, 2.4 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrcl2:

Sequence; same for both SEQRES and ATOM records:

>d1mrcl2 b.1.1.2 (L:109-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqns
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1mrcl2:

• d1mrcl2 first appeared (with stable ids) in SCOP 1.55
  
• d1mrcl2 appears in SCOP 1.65
  
• d1mrcl2 appears in SCOP 1.69
  
• d1mrcl2 appears in the current release, SCOPe 2.08