SCOPe 2.07: Domain d3h0ca2: 3h0c A:509-766

Lineage for d3h0ca2 (3h0c A:509-766)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d3h0ca2: 3h0c A:509-766 [210755]
   Other proteins in same PDB: d3h0ca1, d3h0cb1
   automated match to d1nu6a2
   complexed with nag, ndg, ps4

Details for d3h0ca2

PDB Entry: 3h0c, 2.66 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (cd26) in complex with a reversed amide inhibitor

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3h0ca2:

Sequence; same for both SEQRES and ATOM records:

>d3h0ca2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d3h0ca2:

• d3h0ca2 first appeared in SCOPe 2.03
  
• d3h0ca2 appears in SCOPe 2.06
  
• d3h0ca2 appears in the current release, SCOPe 2.08