Lineage for d3h0ca2 (3h0c A:509-766)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152172Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2152179Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2152180Species Human (Homo sapiens) [TaxId:9606] [82499] (55 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2152269Domain d3h0ca2: 3h0c A:509-766 [210755]
    Other proteins in same PDB: d3h0ca1, d3h0cb1
    automated match to d1nu6a2
    complexed with nag, ndg, ps4

Details for d3h0ca2

PDB Entry: 3h0c (more details), 2.66 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (cd26) in complex with a reversed amide inhibitor
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3h0ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h0ca2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3h0ca2:

Click to download the PDB-style file with coordinates for d3h0ca2.
(The format of our PDB-style files is described here.)

Timeline for d3h0ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h0ca1