SCOPe 2.05: Domain d3gzga_: 3gzg A:

Lineage for d3gzga_ (3gzg A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:92829] [225663] (1 PDB entry)

8. Domain d3gzga_: 3gzg A: [210735]
   automated match to d1amfa_
   complexed with moo, so4; mutant

Details for d3gzga_

PDB Entry: 3gzg, 1.55 Å

PDB Description: crystal structure of the xanthomonas axonopodis pv. citri molybdate- binding protein (moda) mutant (k127s)

PDB Compounds: (A:) Molybdate-binding periplasmic protein; permease

SCOPe Domain Sequences for d3gzga_:

Sequence; same for both SEQRES and ATOM records:

>d3gzga_ c.94.1.0 (A:) automated matches {Xanthomonas axonopodis [TaxId: 92829]}
tapvtvfaaaslkesmdeaatayekatgtpvrvsyaassalarqieqgapadvflsadle
wmdylqqhglvlpaqrhnllgntlvlvapassklrvdprapgaiakalgengrlavgqta
svpagsyaaaalrklgqwdsvsnrlaesesvraalmlvsrgeaplgivygsdaradakvr
vvatfpddshdaivypvaalknsnnpataafvswlgskpakaifarrgfslk

Timeline for d3gzga_:

• d3gzga_ first appeared in SCOPe 2.03
  
• d3gzga_ appears in SCOPe 2.04
  
• d3gzga_ appears in SCOPe 2.06
  
• d3gzga_ appears in the current release, SCOPe 2.08