![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
![]() | Protein Cholesterol oxidase [54375] (3 species) |
![]() | Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries) |
![]() | Domain d3gyja2: 3gyj A:319-450 [210733] Other proteins in same PDB: d3gyja1 automated match to d1ijha2 complexed with fad, so4; mutant |
PDB Entry: 3gyj (more details), 0.92 Å
SCOPe Domain Sequences for d3gyja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gyja2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]} gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk afaddfcyhplg
Timeline for d3gyja2: