Lineage for d3gyja2 (3gyj A:319-450)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935246Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 2935247Protein Cholesterol oxidase [54375] (3 species)
  7. 2935253Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries)
  8. 2935260Domain d3gyja2: 3gyj A:319-450 [210733]
    Other proteins in same PDB: d3gyja1
    automated match to d1ijha2
    complexed with fad, so4; mutant

Details for d3gyja2

PDB Entry: 3gyj (more details), 0.92 Å

PDB Description: cholesterol oxidase from streptomyces sp. n485l mutant (0.92a)
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d3gyja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gyja2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg

SCOPe Domain Coordinates for d3gyja2:

Click to download the PDB-style file with coordinates for d3gyja2.
(The format of our PDB-style files is described here.)

Timeline for d3gyja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gyja1