SCOPe 2.08: Domain d3gyja2: 3gyj A:319-450

Lineage for d3gyja2 (3gyj A:319-450)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Cholesterol oxidase [54375] (3 species)

7. Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries)

8. Domain d3gyja2: 3gyj A:319-450 [210733]
   Other proteins in same PDB: d3gyja1
   automated match to d1ijha2
   complexed with fad, so4; mutant

Details for d3gyja2

PDB Entry: 3gyj, 0.92 Å

PDB Description: cholesterol oxidase from streptomyces sp. n485l mutant (0.92a)

PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d3gyja2:

Sequence; same for both SEQRES and ATOM records:

>d3gyja2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg

Timeline for d3gyja2:

• d3gyja2 first appeared in SCOPe 2.03
  
• d3gyja2 appears in SCOPe 2.07