Lineage for d3gyba_ (3gyb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144097Species Corynebacterium glutamicum [TaxId:1718] [225651] (2 PDB entries)
  8. 2144098Domain d3gyba_: 3gyb A: [210730]
    automated match to d3k9cb_
    complexed with mg

Details for d3gyba_

PDB Entry: 3gyb (more details), 1.6 Å

PDB Description: Crystal structure of a LacI-family transcriptional regulatory protein from Corynebacterium glutamicum
PDB Compounds: (A:) Transcriptional regulators (LACI-FAMILY TRANSCRIPTIONAL REGULATORY PROTEIN)

SCOPe Domain Sequences for d3gyba_:

Sequence, based on SEQRES records: (download)

>d3gyba_ c.93.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
rtqliavliddysnpwfidliqslsdvltpkgyrlsvidsltsqagtdpitsalsmrpdg
iiiaqdipdftvpdslppfviagtritqasthdsvanddfrgaeiatkhlidlghthiah
lrvgsgaglrrfesfeatmrahgleplsndylgpavehagytetlallkehpevtaifss
nditaigalgaarelglrvpedlsiigydntplaqtrlinlttiddnsigvgynaallll
smldpeaphpeimhtlqpsliergtcapr

Sequence, based on observed residues (ATOM records): (download)

>d3gyba_ c.93.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
rtqliavliddysnpwfidliqslsdvltpkgyrlsvidsltsqagtdpitsalsmrpdg
iiiaqdilppfviagtritqasthdsvanddfrgaeiatkhlidlghthiahlrvgsgag
lrrfesfeatmrahgleplsndylgpavehagytetlallkehpevtaifssnditaiga
lgaarelglrvpedlsiigydntplaqtrlinlttiddnsigvgynaallllsmldpeap
hpeimhtlqpsliergtcapr

SCOPe Domain Coordinates for d3gyba_:

Click to download the PDB-style file with coordinates for d3gyba_.
(The format of our PDB-style files is described here.)

Timeline for d3gyba_: